Antibodies

Jump to Filters
View as table Download
HSD17B11 (N-term) Rabbit Polyclonal Antibody
AP52109PU-N

USD 580.00

2 Weeks

HSD17B11 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 88~118 amino acids from the N-terminal region of Human 17-beta-HSD11 / HSD17B11
HSD17B11 Rabbit Polyclonal Antibody
TA343846

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSD17B11 Antibody

Applications IHC
Reactivities Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD17B11 antibody: synthetic peptide directed towards the N terminal of human HSD17B11. Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG
Hsd17b11 Rabbit Polyclonal Antibody
TA356116

USD 539.00

5 Days

Hsd17b11 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
HSD17B11 Rabbit Polyclonal Antibody
TA359651

USD 539.00

5 Days

HSD17B11 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human DHB11