HSD17B11 Rabbit Polyclonal Antibody

CAT#: TA343846

Rabbit Polyclonal Anti-HSD17B11 Antibody

Product Images

Sample Type: Monkey adrenal gland; Primary Antibody Dilution: 1: 25; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: 1: 1000; Color/Signal Descriptions: Brown: HSD17B11 Blue: Nucleus; Gene Name: HSD17B11; Submitted by: Jonathan Bertin, E

• 

  Sample Type: Monkey vagina; Primary Antibody Dilution: 1: 25; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: 1: 1000; Color/Signal Descriptions: Brown: HSD17B11 Blue: Nucleus; Gene Name: HSD17B11; Submitted by: Jonathan Bertin, Endoceut

Specifications

Product Data

• Applications: IHC
• Recommended Dilution: IHC, WB
• Reactivities: Monkey
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HSD17B11 antibody: synthetic peptide directed towards the N terminal of human HSD17B11. Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: hydroxysteroid (17-beta) dehydrogenase 11
• Database Link:
  NP_057329
  Entrez Gene 51170 Human
  UniProt ID Q8NBQ5
• Background: Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al., 2001 [PubMed 11165019]).
• Synonyms: 17-BETA-HSD11; 17-BETA-HSDXI; 17BHSD11; DHRS8; PAN1B; RETSDR2; SDR16C2
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 93%; Rabbit: 93%; Pig: 92%; Rat: 92%; Mouse: 92%; Guinea pig: 92%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein