Antibodies

View as table Download

Rabbit Polyclonal Anti-RHOC Antibody

Applications IHC, WB
Reactivities Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi
Conjugation Unconjugated
Immunogen The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF

Rabbit Polyclonal Anti-RAB4B Antibody

Reactivities Human, Mouse, Pig, Dog, Horse, Zebrafish, Brugia malayi
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB4B antibody is: synthetic peptide directed towards the middle region of Human RAB4B. Synthetic peptide located within the following region: SPNIVVILCGNKKDLDPEREVTFLEASRFAQENELMFLETSALTGENVEE