IGF2BP1 mouse monoclonal antibody,clone OTI1F7
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
IGF2BP1 mouse monoclonal antibody,clone OTI1F7
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IGF2BP1 mouse monoclonal antibody,clone OTI1F7
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Anti-IGF2BP1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 554-568 amino acids of Human insulin-like growth factor 2 mRNA binding protein 1 |
IGF2BP1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 515-542 amino acids from the C-terminal region of human IGF2BP1 |
Anti-IGF2BP1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 554-568 amino acids of Human insulin-like growth factor 2 mRNA binding protein 1 |
Rabbit Polyclonal Anti-IGF2BP1 Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IGF2BP1 antibody: synthetic peptide directed towards the N terminal region of human IGF2BP1. Synthetic peptide located within the following region: AFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPP |
Rabbit Polyclonal Anti-IGF2BP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IGF2BP1 antibody: synthetic peptide directed towards the N terminal of human IGF2BP1. Synthetic peptide located within the following region: PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT |
IGF2BP1 Rabbit monoclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
IGF2BP1 mouse monoclonal antibody,clone OTI1F7
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit anti-IGF2BP1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human IGF2BP1 |
Goat Anti-IGF2BP1 (IMP1) Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EKVFAEHKISYSGQ, from the Internal region of the protein sequence according to NP_006537.3; NP_001153895.1. |