Histamine rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Human, Insect, Rat |
Conjugation | Unconjugated |
Histamine rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Human, Insect, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GABARAP
Applications | WB |
Reactivities | Human, Insect, Cow, Dog, Mouse, Pig, Rabbit, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |