GABARAP Rabbit Polyclonal Antibody

CAT#: TA339169

Rabbit Polyclonal Anti-GABARAP

Product Images

Autophagy is induced by starvationSample: Newborn M. Sexta larvae; Lanes: Newborn larvae were treated for 0, 0.5, 1, 2, 3, 4, and 5 h; Protein Loaded: 100 ug per lane; Submitted by: Dra. Helena Porta Ducoing, Instituto de Biotechnologia, UNAM

• 

  WB Suggested Anti-GABARAP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HT1080 cell lysate GABARAP is supported by BioGPS gene expression data to be expressed in HT1080

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Insect, Cow, Dog, Mouse, Pig, Rabbit, Rat, Zebrafish
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: GABA type A receptor-associated protein
• Database Link:
  NP_009209
  Entrez Gene 56486 MouseEntrez Gene 58974 RatEntrez Gene 479479 DogEntrez Gene 11337 Human
  UniProt ID O95166
• Background: Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. GABA(A) receptor-associated protein (GABARAP) is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.
• Synonyms: ATG8A; GABARAP-a; MM46
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Horse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Regulation of autophagy