Rabbit Monoclonal e-cadherin Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal e-cadherin Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Phospho-PPAR- gamma (Ser112) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR- gamma around the phosphorylation site of Serine 112 |
Modifications | Phospho-specific |
Rabbit Polyclonal HER2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HER2 |
Rabbit Polyclonal Phospho-c-Kit (Tyr721) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human c-Kit around the phosphorylation site of Tyrosine 721. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PIK3CB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIK3CB antibody: synthetic peptide directed towards the C terminal of human PIK3CB. Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD |
Rabbit Polyclonal Anti-E2F1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F1 antibody: synthetic peptide directed towards the N terminal of human E2F1. Synthetic peptide located within the following region: PARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWA |
Rabbit Polyclonal Anti-RXRA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the C terminal of human RXRA. Synthetic peptide located within the following region: MDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQ |
Rabbit anti-FOS Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human FOS |
Rabbit anti-CDKN1B Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CDKN1B |
Rabbit anti-IGF1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human IGF1 |
Rabbit anti-BIRC5 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant Protein of human BIRC5 |
Rabbit anti-TCEB2 Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TCEB2 |
Rabbit anti-PIAS2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PIAS2 |
Rabbit anti-MSH3 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MSH3 |
Rabbit anti-GRB2 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRB2 |