Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-TAS2R48 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TAS2R48. |
Antibodies
View as table Download
Rabbit Polyclonal mGluR4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human mGluR4. |
Rabbit polyclonal Anti-ASIC2a
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide DLKESPSEGSLQPSSIQC, corresponding to amino acid residues 2-18 of human ASIC2a. Intracellular, N-terminus. |
Rabbit Polyclonal Anti-TAS2R16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAS2R16 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS2R16. Synthetic peptide located within the following region: TILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC |
Rabbit Polyclonal Anti-GNG3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GNG3 antibody is: synthetic peptide directed towards the middle region of Human GNG3. Synthetic peptide located within the following region: IEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCAL |
Rabbit Polyclonal Anti-TAS2R7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAS2R7 Antibody is: synthetic peptide directed towards the middle region of Human TAS2R7. Synthetic peptide located within the following region: DFRFCVKAKRKTNLTWSCRVNKTQHASTKLFLNLATLLPFCVCLMSFFLL |
Rabbit Polyclonal Anti-TAS2R3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAS2R3 Antibody is: synthetic peptide directed towards the middle region of Human TAS2R3. Synthetic peptide located within the following region: VMVWMLLGALLLSCGSTASLINEFKLYSVFRGIEATRNVTEHFRKKRSEY |
Rabbit Polyclonal Anti-TAS2R3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAS2R3 Antibody is: synthetic peptide directed towards the C-terminal region of Human TAS2R3. Synthetic peptide located within the following region: RQMLQNGTSSRDPTTEAHKRAIRIILSFFFLFLLYFLAFLIASFGNFLPK |
Rabbit Polyclonal Anti-TAS2R50 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAS2R50 Antibody is: synthetic peptide directed towards the C-terminal region of Human TAS2R50. Synthetic peptide located within the following region: PFTLSLISFLMLICSLCKHLKKMQLHGEGSQDLSTKVHIKALQTLISFLL |
Rabbit Polyclonal Anti-Bnc1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Bnc1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI |
Rabbit Polyclonal Anti-KCNB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNB1 antibody: synthetic peptide directed towards the middle region of human KCNB1. Synthetic peptide located within the following region: YIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPT |
Rabbit Polyclonal Anti-TAS2R45 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAS2R45 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS2R45. Synthetic peptide located within the following region: MLANLVPFTVTLISFLLLVCSLCKHLKKMQLHGKGSQDPSTKVHIKVLQT |
Rabbit Polyclonal Anti-GNB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNB1 antibody: synthetic peptide directed towards the C terminal of human GNB1. Synthetic peptide located within the following region: DLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKAD |
Rabbit Polyclonal Anti-PDE1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDE1A Antibody: synthetic peptide directed towards the C terminal of human PDE1A. Synthetic peptide located within the following region: AVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDET |
Rabbit Polyclonal Anti-PRKACB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACB antibody: synthetic peptide directed towards the N terminal of human PRKACB. Synthetic peptide located within the following region: MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTL |
Active filters
Pathways
- Taste transduction
Filter by
Category
Target Symbol
- G PROTEIN ALPHA S (47)
- PDE1A (19)
- METABOTROPIC GLUTAMATE RECEPTOR 4 (10)
- PRKACA (8)
- ACCN1 (7)
- EPITHELIAL SODIUM CHANNEL ALPHA (6)
- ADCY4 (5)
- TAS1R1 (5)
- GNAT3 (4)
- KV2.1 (4)
- PRKACB (4)
- PRKX (4)
- TAS1R2 (4)
- ADCY6 (3)
- GNB1 (3)
- PRKACG (3)
- TRPM5 (3)
- ADCY8 (2)
- EPITHELIAL SODIUM CHANNEL GAMMA (2)
- GNB3 (2)
- PHOSPHOLIPASE C BETA 2 (2)
- SCNN1B (2)
- TAS2R1 (2)
- TAS2R13 (2)
- TAS2R14 (2)
- TAS2R3 (2)
- TAS2R7 (2)
- CACNA1A (1)
- GNG3 (1)
- ITPR3 (1)
- T2R50 (1)
- TAS1R3 (1)
- TAS2R10 (1)
- TAS2R16 (1)
- TAS2R39 (1)
- TAS2R43 (1)
- TAS2R44 (1)
- TAS2R45 (1)
- TAS2R48 (1)
- TAS2R49 (1)
- TAS2R5 (1)
- TAS2R8 (1)