Antibodies

View as table Download

Rabbit polyclonal anti-TAS2R48 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TAS2R48.

Rabbit Polyclonal mGluR4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human mGluR4.

Rabbit polyclonal Anti-ASIC2a

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide DLKESPSEGSLQPSSIQC, corresponding to amino acid residues 2-18 of human ASIC2a. Intracellular, N-terminus.

Rabbit Polyclonal Anti-TAS2R16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAS2R16 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS2R16. Synthetic peptide located within the following region: TILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC

Rabbit Polyclonal Anti-GNG3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GNG3 antibody is: synthetic peptide directed towards the middle region of Human GNG3. Synthetic peptide located within the following region: IEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCAL

Rabbit Polyclonal Anti-TAS2R7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAS2R7 Antibody is: synthetic peptide directed towards the middle region of Human TAS2R7. Synthetic peptide located within the following region: DFRFCVKAKRKTNLTWSCRVNKTQHASTKLFLNLATLLPFCVCLMSFFLL

Rabbit Polyclonal Anti-TAS2R3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAS2R3 Antibody is: synthetic peptide directed towards the middle region of Human TAS2R3. Synthetic peptide located within the following region: VMVWMLLGALLLSCGSTASLINEFKLYSVFRGIEATRNVTEHFRKKRSEY

Rabbit Polyclonal Anti-TAS2R3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAS2R3 Antibody is: synthetic peptide directed towards the C-terminal region of Human TAS2R3. Synthetic peptide located within the following region: RQMLQNGTSSRDPTTEAHKRAIRIILSFFFLFLLYFLAFLIASFGNFLPK

Rabbit Polyclonal Anti-TAS2R50 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAS2R50 Antibody is: synthetic peptide directed towards the C-terminal region of Human TAS2R50. Synthetic peptide located within the following region: PFTLSLISFLMLICSLCKHLKKMQLHGEGSQDLSTKVHIKALQTLISFLL

Rabbit Polyclonal Anti-Bnc1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Bnc1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI

Rabbit Polyclonal Anti-KCNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNB1 antibody: synthetic peptide directed towards the middle region of human KCNB1. Synthetic peptide located within the following region: YIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPT

Rabbit Polyclonal Anti-TAS2R45 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAS2R45 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS2R45. Synthetic peptide located within the following region: MLANLVPFTVTLISFLLLVCSLCKHLKKMQLHGKGSQDPSTKVHIKVLQT

Rabbit Polyclonal Anti-GNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNB1 antibody: synthetic peptide directed towards the C terminal of human GNB1. Synthetic peptide located within the following region: DLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKAD

Rabbit Polyclonal Anti-PDE1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDE1A Antibody: synthetic peptide directed towards the C terminal of human PDE1A. Synthetic peptide located within the following region: AVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDET

Rabbit Polyclonal Anti-PRKACB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKACB antibody: synthetic peptide directed towards the N terminal of human PRKACB. Synthetic peptide located within the following region: MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTL