ACCN1 Rabbit Polyclonal Antibody

CAT#: TA334107

Rabbit Polyclonal Anti-Bnc1 Antibody

Product Images

WB Suggested Anti-Bnc1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Mouse Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Bnc1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 110 kDa
• Database Link:
  NP_001085.2
  Entrez Gene 11418 Mouse
• Background: The function of Bnc1 remains unknown.
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Guinea pig: 93%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other
• Protein Pathways: Taste transduction