Rabbit Polyclonal FALDH Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal FALDH Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal anti-iNOS antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human iNOS. |
Rabbit Polyclonal Anti-GLUD1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER |
USD 379.00
2 Weeks
GS(Glul) Rabbit monoclonal antibody,clone UMAB296
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
2 Weeks
GS(Glul) Rabbit monoclonal antibody,clone UMAB297
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal GLS Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Rat) |
Conjugation | Unconjugated |
Immunogen | This GLS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 516-545 amino acids from the C-terminal region of human GLS. |
Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-P5CR1 antibody for SISCAPA, clone OTIR1E8
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Anti-Arginase I Antibody
Applications | FC, IF, IHC, PEP-ELISA, WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CFGLAREGNHKPID, from the C Terminus of the protein sequence according to NP_000036.2. |
USD 150.00
2 Weeks
GS(Glul) Rabbit monoclonal antibody,clone UMAB296
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 150.00
2 Weeks
GS(Glul) Rabbit monoclonal antibody,clone UMAB297
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to Argininosuccinate Lyase (argininosuccinate lyase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 13 and 261 of ASL (Uniprot ID#P04424) |
Rabbit Polyclonal antibody to Arginase I (arginase, liver)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 322 of Arginase I (Uniprot ID#P05089) |
Rabbit Polyclonal antibody to Creatine kinase (brain) (creatine kinase, brain)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Bovine, Chicken, Pig, Rabbit, Xenopus, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 165 and 381 of Creatine kinase (brain) (Uniprot ID#P12277) |
Anti-ALDH9A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1 |