Rabbit Polyclonal Anti-COL26A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL26A1 antibody: synthetic peptide directed towards the C terminal of human COL26A1. Synthetic peptide located within the following region: LAGERGTVGPSGEPGVKGEEGEKAATAEGEGVQQLREALKILAERVLILE |
Rabbit Polyclonal Anti-COL26A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL26A1 antibody: synthetic peptide directed towards the C terminal of human COL26A1. Synthetic peptide located within the following region: GVQQLREALKILAERVLILEHMIGIHDPLASPEGGSGQDAALRANLKMKR |
Germany
Japan
United Kingdom
China