Rabbit Polyclonal Anti-GTF2I Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GTF2I |
Rabbit Polyclonal Anti-GTF2I Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GTF2I |
Rabbit polyclonal GTF2I Antibody (N-term)
Applications | IF, WB |
Reactivities | Human (Predicted: Mouse, Rat) |
Conjugation | Unconjugated |
Immunogen | This GTF2I antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-310 amino acids from the N-terminal region of human GTF2I. |
Rabbit Polyclonal Anti-GTF2I Antibody - middle region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2I antibody: synthetic peptide directed towards the middle region of human GTF2I. Synthetic peptide located within the following region: INNQLVDQSESEGPVIQESAEPSQLEVPATEEIKETDGSSQIKQEPDPTW |