Rabbit Polyclonal KCNK12 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | KCNK12 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of human KCNK12. |
Rabbit Polyclonal KCNK12 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | KCNK12 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of human KCNK12. |
Rabbit polyclonal anti-KCNK12 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human KCNK12. |
Rabbit Polyclonal Anti-KCNK12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNK12 antibody: synthetic peptide directed towards the middle region of human KCNK12. Synthetic peptide located within the following region: EGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGF |