Antibodies

View as table Download

Rabbit polyclonal anti-GPR12 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR12.

Rabbit Polyclonal Anti-GPR12 Antibody (C-Terminus)

Applications IHC
Reactivities Human (Predicted: Mouse, Dog, Pig)
Conjugation Unconjugated
Immunogen GPR12 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GPR12 / GPCR12. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Mouse, Panda, Dog, Pig (94%); Hamster, Elephant, Bat, Horse, Rabbit, Opossum, Turkey (88%); Rat, Bovine, Chicken, Platypus, Xenopus, Stickleback (81%).

GPR12 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-GPR12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR12 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR12. Synthetic peptide located within the following region: SICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLY

Rabbit Polyclonal Anti-GPR12 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human (Predicted: Bat, Rabbit)
Conjugation Unconjugated
Immunogen GPR12 antibody was raised against synthetic 16 amino acid peptide from 1st extracellular domain of human GPR12 / GPCR12. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bovine, Hamster, Panda, Horse, Pig, Opossum (100%); Bat, Elephant, Rabbit (94%); Turkey, Chicken (88%); Platypus, Xenopus (81%).

GPR12 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GPR12