GPR12 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPR12 |
GPR12 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPR12 |
Rabbit polyclonal anti-GPR12 antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR12. |
Rabbit Polyclonal Anti-GPR12 Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human (Predicted: Mouse, Dog, Pig) |
Conjugation | Unconjugated |
Immunogen | GPR12 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GPR12 / GPCR12. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Mouse, Panda, Dog, Pig (94%); Hamster, Elephant, Bat, Horse, Rabbit, Opossum, Turkey (88%); Rat, Bovine, Chicken, Platypus, Xenopus, Stickleback (81%). |
GPR12 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GPR12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPR12 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR12. Synthetic peptide located within the following region: SICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLY |
Rabbit Polyclonal Anti-GPR12 Antibody (Extracellular Domain)
Applications | IHC |
Reactivities | Human (Predicted: Bat, Rabbit) |
Conjugation | Unconjugated |
Immunogen | GPR12 antibody was raised against synthetic 16 amino acid peptide from 1st extracellular domain of human GPR12 / GPCR12. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bovine, Hamster, Panda, Horse, Pig, Opossum (100%); Bat, Elephant, Rabbit (94%); Turkey, Chicken (88%); Platypus, Xenopus (81%). |
GPR12 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GPR12 |
GPR12 rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from C-term domain of human GPR12 |
GPR12 rabbit polyclonal antibody, Serum
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides derived from internal domain of the human GPSM1 protein |