GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Anti-GRK4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 36-145 amino acids of human G protein-coupled receptor kinase 4 |
Rabbit Polyclonal Anti-GRK4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GRK4 Antibody: synthetic peptide directed towards the middle region of human GRK4. Synthetic peptide located within the following region: QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY |
Rabbit Polyclonal Anti-GRK4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GRK4 Antibody: synthetic peptide directed towards the middle region of human GRK4. Synthetic peptide located within the following region: EKVKWEEVDQRIKNDTEEYSEKFSEDAKSICRMLLTKNPSKRLGCRGEGA |
GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |