Antibodies

Jump to Filters
View as table Download
C2 Rabbit Polyclonal Antibody
TA346155

USD 539.00

5 Days

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS
Factor VII (F7) Mouse Monoclonal Antibody [Clone ID: RFFVII/2]
AM09326PU-N

USD 745.00

5 Days

Factor VII (F7) mouse monoclonal antibody, clone RFFVII/2, Aff - Purified

Applications ELISA, R, WB
Reactivities Human
Conjugation Unconjugated