Rabbit Polyclonal DPAGT1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | DPAGT1 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human DPAGT1. |
Rabbit Polyclonal DPAGT1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | DPAGT1 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human DPAGT1. |
Rabbit Polyclonal Anti-DPAGT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DPAGT1 antibody is: synthetic peptide directed towards the C-terminal region of Human DPAGT1. Synthetic peptide located within the following region: TKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLG |
DPAGT1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 293~323 amino acids from the Central region of Human DPAGT1 |