Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 13 of 13 results

(reset)

PTCH1 Mouse Monoclonal Antibody [Clone ID: OTI5C7]

TA500123

USD 478.00

In Stock

Patched1 (Patched) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: UMAB15]

UM500015

USD 564.00

In Stock

Beta-Catenin (CTNNB1) mouse monoclonal antibody, clone UMAB15

Applications	10k-ChIP, FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Monkey
Conjugation	Unconjugated

• 

1 / 23

2 / 23

3 / 23

4 / 23

5 / 23

6 / 23

7 / 23

8 / 23

9 / 23

10 / 23

11 / 23

12 / 23

13 / 23

14 / 23

15 / 23

16 / 23

17 / 23

18 / 23

19 / 23

20 / 23

21 / 23

22 / 23

23 / 23

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI12H7]

TA502409

USD 447.00

In Stock

CTNNB1 mouse monoclonal antibody, clone OTI12H7 (formerly 12H7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

GLI1 Mouse Monoclonal Antibody [Clone ID: UMAB170]

UM800063

USD 564.00

In Stock

GLI1 mouse monoclonal antibody,clone UMAB170

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

PTCH1 Mouse Monoclonal Antibody [Clone ID: OTI5C7]

TA500123S

USD 200.00

In Stock

Patched1 (Patched) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI12H7]

TA502409S

USD 200.00

In Stock

CTNNB1 mouse monoclonal antibody, clone OTI12H7 (formerly 12H7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

GLI2 Mouse Monoclonal Antibody [Clone ID: OTI1G1]

TA804601

USD 447.00

In Stock

GLI2 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

beta Catenin (CTNNB1) Goat Polyclonal Antibody

AB0095-200

USD 355.00

In Stock

Goat Polyclonal Anti-beta-Catenin Antibody

Applications	IF, WB
Reactivities	Canine, Human, Monkey, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli.

1 / 2

2 / 2

Previous Next

WNT2 Rabbit Polyclonal Antibody

TA351948

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-WNT2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human WNT2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PTCH1 (C-term) Goat Polyclonal Antibody

AP22448PU-N

USD 520.00

5 Days

PTCH1 (C-term) goat polyclonal antibody, Aff - Purified

Applications	ELISA, IF, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide with sequence from the C Terminus of Human PTCH1 (NP_001077073.1, NP_001077074.1, NP_001077075.1, NP_001077076.1)

Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody

TA334657

USD 539.00

5 Days

Rabbit Polyclonal Anti-SHH Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Chicken
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT

1 / 3

2 / 3

3 / 3

Previous Next

beta Catenin (CTNNB1) Rabbit Polyclonal Antibody

TA313140

USD 380.00

In Stock

Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L).
Modifications	Phospho-specific

beta Catenin (CTNNB1) Rabbit Polyclonal Antibody

TA313134

USD 380.00

In Stock

Rabbit polyclonal Catenin-beta (Ab-489) antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized non-phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L).

1 - 13 of 13 results