CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CLDN5 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4), Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4), HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-CLDN5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 202-215 amino acids of Human claudin 5 |
Rabbit polyclonal anti-Claudin 5 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human CLDN5. |
CLDN5 (Claudin 5) mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-CLDN5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 202-215 amino acids of Human claudin 5 |
Rabbit Polyclonal Anti-Claudin 5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5 |
Rabbit Polyclonal Anti-CLDN5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLDN5 antibody: synthetic peptide directed towards the C terminal of human CLDN5. Synthetic peptide located within the following region: GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN |
Rabbit Polyclonal Anti-Claudin 5 Antibody
Applications | WB |
Reactivities | Mouse, Rat, Human, Pig, Cow |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5 |
Rabbit polyclonal Claudin 5 (Tyr217) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Claudin 5 around the phosphorylation site of tyrosine 217 (K-N-YP-V). |
Modifications | Phospho-specific |
Rabbit anti Claudin 5 Polyclonal Antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |