Rabbit Polyclonal Antibody against Mre11
Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length human Mre11 protein |
Rabbit Polyclonal Antibody against Mre11
Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length human Mre11 protein |
Rabbit monoclonal anti-RFA2 antibody for SISCAPA, clone OTIR2G2
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to RPA70 (replication protein A1, 70kDa)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 369 and 616 of RPA70 (Uniprot ID#P27694) |
Rabbit Polyclonal Anti-MRE11A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MRE11A |
Rabbit polyclonal antibody to RPA 32 kDa subunit (replication protein A2, 32kDa)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 202 of RPA32 (Uniprot ID#P15927) |
Rabbit Polyclonal MRE11 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | MRE11 antibody was raised against a 14 amino acid peptide from near the amino terminus human MRE11. |
Anti-RAD51 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 301-312 amino acids of Human RAD51 homolog (S. cerevisiae) |
Rabbit Polyclonal Anti-RAD51 Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RAD51 Antibody: synthetic peptide directed towards the N terminal of human RAD51. Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS |
Rabbit polyclonal Anti-RPA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RPA1 antibody: synthetic peptide directed towards the middle region of human RPA1. Synthetic peptide located within the following region: TLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEA |
Rabbit Polyclonal Anti-RPA2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit polyclonal antibody to DNA pol delta cat (polymerase (DNA directed), delta 1, catalytic subunit 125kDa)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 685 and 1071 of DNA pol delta cat (Uniprot ID#P28340) |
Rabbit polyclonal antibody to RPA 14 kDa subunit (replication protein A3, 14kDa)
Applications | IHC, WB |
Reactivities | Human (Predicted: Cow) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 121 of RPA14 (Uniprot ID#P35244) |
Rabbit polyclonal Bloom Syndrome Protein (Thr99)(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Bloom Syndrome Protein around the phosphorylation site of threonine 99 (Q-E-TP-Q-R). |
Modifications | Phospho-specific |
Rabbit anti-POLD1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLD1 |
Rabbit Polyclonal Anti-MRE11A Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MRE11A |