PTEN mouse monoclonal antibody, clone OTI5A5 (formerly 5A5)
Applications | IHC |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
PTEN mouse monoclonal antibody, clone OTI5A5 (formerly 5A5)
Applications | IHC |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
PTEN mouse monoclonal antibody, clone OTI5A5 (formerly 5A5), Biotinylated
Applications | IHC |
Reactivities | Mouse, Rat |
Conjugation | Biotin |
PTEN mouse monoclonal antibody, clone OTI5A5 (formerly 5A5), HRP conjugated
Applications | IHC |
Reactivities | Mouse, Rat |
Conjugation | HRP |
PTEN mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Reactivities | Human |
Conjugation | Unconjugated |
PTEN mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTEN mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTEN mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)
Reactivities | Human |
Conjugation | Unconjugated |
PTEN mouse monoclonal antibody,clone 1C3, Biotinylated
Reactivities | Human |
Conjugation | Biotin |
PTEN mouse monoclonal antibody,clone 1C3, HRP conjugated
Reactivities | Human |
Conjugation | HRP |
PTEN mouse monoclonal antibody,clone 2H9, Biotinylated
Reactivities | Human |
Conjugation | Biotin |
PTEN mouse monoclonal antibody,clone 2H9, HRP conjugated
Reactivities | Human |
Conjugation | HRP |
Mouse anti pTEN Monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PTEN rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 381-396 amino acids of human phosphatase and tensin homolog |
Rabbit Polyclonal Anti-INPP5K Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF |
Rabbit polyclonal PTEN (Ab-370) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of serine 370. |