USD 494.00
In Stock
IL-4 biotinylated rat monoclonal detection antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Biotin |
Matched ELISA Pair | TA600022 |
USD 494.00
In Stock
IL-4 biotinylated rat monoclonal detection antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Biotin |
Matched ELISA Pair | TA600022 |
IL-4 mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700022 |
Rabbit polyclonal IL4 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse (Predicted: Monkey) |
Conjugation | Unconjugated |
Immunogen | This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4. |
IL4 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (>98%) recombinant hIL-4 (human IL-4) |
IL4 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (>98%) recombinant hIL-4 (human IL-4) |
Rabbit polyclonal anti-IL4 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human IL4. |
Rabbit Polyclonal Anti-Interleukin 4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interleukin 4 Antibody: A synthesized peptide derived from human Interleukin 4 |
IL4 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Interleukin-4 / IL4 rat monoclonal antibody, clone 11B4
Applications | ELISA, IP, Neutralize |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-IL-4 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit polyclonal IL-4 antibody Peroxidase Conjugated
Applications | WB |
Reactivities | Human |
Conjugation | Peroxidase |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit polyclonal IL-4 antibody Biotin Conjugated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit Polyclonal Anti-IL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC |
Rabbit Polyclonal Anti-IL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS |
IL4 mouse monoclonal antibody, clone B-S4, Azide Free
Applications | FN |
Reactivities | Human |
Conjugation | Unconjugated |