PTCH2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
PTCH2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
PTCH2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTCH2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTCH2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
PTCH2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5), Biotinylated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
PTCH2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
USD 509.00
2 Weeks
PTCH2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5), Biotinylated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
PTCH2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
Rabbit Polyclonal Anti-PTCH2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTCH2 antibody: synthetic peptide directed towards the N terminal of human PTCH2. Synthetic peptide located within the following region: LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV |
PTCH2 mouse monoclonal antibody, clone OTI8B5 (formerly 8B5)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
PTCH2 mouse monoclonal antibody, clone OTI1F5 (formerly 1F5)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |