Anti-DTX2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human deltex homolog 2 (Drosophila) |
Anti-DTX2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human deltex homolog 2 (Drosophila) |
Rabbit Polyclonal Anti-DTX2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DTX2 antibody: synthetic peptide directed towards the C terminal of human DTX2. Synthetic peptide located within the following region: EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE |