Antibodies

View as table Download

Rabbit monoclonal anti-UCHL1 Antibody, clone OTIR2F11

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker

Applications FC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Monkey, Rat, Porcine, Horse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936]

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 9.

Goat Polyclonal Anti-Cathepsin D Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli.

Rabbit Polyclonal Cathepsin D Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Anti-MMP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 12-200 amino acids of human matrix metallopeptidase 1 (interstitial collagenase)

Anti-ADAMTS16 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1076-1090 amino acids of human ADAM metallopeptidase with thrombospondin type 1 motif, 16

Rabbit Polyclonal Anti-TMPRSS6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK

USD 190.00

USD 380.00

In Stock

Anti-AGA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 206-346 amino acids of human aspartylglucosaminidase

Rabbit monoclonal anti-PARK7 antibody for SISCAPA, clone OTIR4F10

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit monoclonal anti-CATB antibody for SISCAPA, clone OTIR1C4

Applications SISCAPA
Reactivities Human
Conjugation Unconjugated

Goat Polyclonal Anti-Cathepsin D Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli.

Rabbit Polyclonal CD10 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Anti-NAPSA Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NAPSA

Rabbit Polyclonal Anti-TMPRSS11E Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TMPRSS11E