Anti-CCR8 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 175-191 amino acids of Human chemokine (C-C motif) receptor 8 |
Anti-CCR8 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 175-191 amino acids of Human chemokine (C-C motif) receptor 8 |
Anti-CCR8 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 175-191 amino acids of Human C-C chemokine receptor type 8 |
CCR8 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 297-325 amino acids from the C-terminal region of human CCR8 |
Rabbit Polyclonal CCR8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CCR8 antibody was raised against a peptide corresponding to amino acids 183 to 201 of human CCR8, which locate in the second extracellular loop. |
Rabbit Polyclonal Anti-CCR8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCR8 antibody: synthetic peptide directed towards the middle region of human CCR8. Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT |