CCR8 Rabbit Polyclonal Antibody

CAT#: TA330415

Rabbit Polyclonal Anti-CCR8 Antibody

Product Images

WB Suggested Anti-CCR8 Antibody Titration: 2.5ug/ml; Positive Control: K562 cell lysateCCR8 is supported by BioGPS gene expression data to be expressed in K562

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCR8 antibody: synthetic peptide directed towards the middle region of human CCR8. Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: C-C motif chemokine receptor 8
• Database Link:
  NP_005192
  Entrez Gene 1237 Human
  UniProt ID P51685
• Background: CCR8 is a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are important for the migration of various cell types into the inflammatory sites. This receptor protein preferentially expresses in the thymus. I-309, thymus activation-regulated cytokine (TARC) and macrophage inflammatory protein-1 beta (MIP-1 beta) have been identified as ligands of this receptor. Studies of this receptor and its ligands suggested its role in regulation of monocyte chemotaxis and thymic cell apoptosis. More specifically, this receptor may contribute to the proper positioning of activated T cells within the antigenic challenge sites and specialized areas of lymphoid tissues. Its gene is located at the chemokine receptor gene cluster region.
• Synonyms: CC-CKR-8; CCR-8; CDw198; CKRL1; CMKBR8; CMKBRL2; CY6; GPRCY6; TER1
• Note: Immunogen sequence homology: Human: 100%; Bovine: 93%; Rabbit: 81%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction