Antibodies

View as table Download

ACY3 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

ABAT mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody, clone OTI6H1 (formerly 6H1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody, clone OTI7C4 (formerly 7C4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody, clone OTI7E9 (formerly 7E9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GLS2 mouse monoclonal antibody,clone OTI1C12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CAD mouse monoclonal antibody,clone OTI10A3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GLUD1 (+Glutamate dehydrogenase 2) goat polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_005262.1; NP_036216.2.

Rabbit Polyclonal Anti-ADSL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADSL antibody: synthetic peptide directed towards the middle region of human ADSL. Synthetic peptide located within the following region: RVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFI

Rabbit Polyclonal Anti-GOT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV

ASS1 mouse monoclonal antibody, clone OTI8A3 (formerly 8A3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CAD mouse monoclonal antibody,clone OTI1A7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated