Antibodies

View as table Download

Rabbit Polyclonal antibody to FTCD (formiminotransferase cyclodeaminase)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Pig, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 251 of FTCD (Uniprot ID#O95954)

Rabbit Polyclonal Anti-ATIC Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ATIC

Rabbit polyclonal antibody to ATIC (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Chicken, Pig, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 310 and 580 of ATIC (Uniprot ID#P31939)

Goat Polyclonal Antibody against MTR

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig)
Conjugation Unconjugated
Immunogen Peptide with sequence C-VEKWLGPILGYDTD, from the C Terminus of the protein sequence according to NP_000245.

Goat Polyclonal Anti-FTCD Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 50 aa to the N-terminus of human FTCD produced in E. coli.

Goat Anti-MTHFD1 Antibody

Applications IHC, PEP-ELISA, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence RGDLNDCFIPCTPK, from the internal region of the protein sequence according to NP_005947.2.

Rabbit Polyclonal Anti-MTHFD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the N terminal of human MTHFD1. Synthetic peptide located within the following region: RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD

Goat Polyclonal Antibody against FTCD (Internal region)

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Pig)
Conjugation Unconjugated
Immunogen Peptide with sequence CLREQGRGKDQPGRL, from the internal region of the protein sequence according to NP_006648.1; NP_996848.1.

Rabbit Polyclonal Anti-ATIC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATIC antibody: synthetic peptide directed towards the middle region of human ATIC. Synthetic peptide located within the following region: RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the N terminal of human SHMT2. Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the C terminal of human SHMT2. Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE

Rabbit Polyclonal Anti-MTHFD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the middle region of human MTHFD1. Synthetic peptide located within the following region: CMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPG

Rabbit Polyclonal Anti-ATIC Antibody

Applications WB
Reactivities Human, Hamster
Conjugation Unconjugated
Immunogen The immunogen for anti-ATIC antibody: synthetic peptide directed towards the N terminal of human ATIC. Synthetic peptide located within the following region: YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG

Rabbit polyclonal antibody to MTHFR (5,10-methylenetetrahydrofolate reductase (NADPH))

Applications WB
Reactivities Human (Predicted: Mouse, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 21 and 248 of MTHFR (Uniprot ID#P42898)

Rabbit Polyclonal Anti-MTHFD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2. Synthetic peptide located within the following region: EAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYV