Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal anti-BDNF antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit polyclonal BAX Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX. |
Anti-BAX Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 2-172 amino acids of human BCL2-associated X protein |
Anti-BCL2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 41-54 amino acids of Human B-cell CLL/lymphoma 2 |
Rabbit Polyclonal Anti-BDNF Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human, Macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Anti-SORT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SORT1 |
Rabbit polyclonal BAX Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX. |
Rabbit Polyclonal Presenilin1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1. |
Rabbit polyclonal anti-BAX antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BAX. |
Rabbit Polyclonal Anti-NTRK3
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NTRK3 antibody: synthetic peptide directed towards the C terminal of human NTRK3. Synthetic peptide located within the following region: ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG |
Goat Polyclonal Anti-BAX Antibody
Applications | IF, WB |
Reactivities | Human, Rat, Mouse, Canine, Monkey |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 90 aa to the N-terminus of human BAX produced in E. coli. |
Rabbit polyclonal Trk B (Tyr515) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Trk B around the phosphorylation site of tyrosine 515 (P-Q-YP-F-G). |
Modifications | Phospho-specific |
Rabbit polyclonal FAS ligand antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FAS ligand. |
Anti-BDNF Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-247 amino acids of human brain-derived neurotrophic factor |