Rabbit Polyclonal Anti-HCK Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HCK |
Rabbit Polyclonal Anti-HCK Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HCK |
Rabbit polyclonal HCK Antibody (N-term)
Applications | FC, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Monkey) |
Conjugation | Unconjugated |
Immunogen | This HCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 131-156 amino acids from the N-terminal region of human HCK. |
HCK Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HCK |
Rabbit Polyclonal Anti-HCK Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HCK antibody is: synthetic peptide directed towards the C-terminal region of Human HCK. Synthetic peptide located within the following region: LVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIA |
Rabbit polyclonal HCK (Tyr521) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HCK around the phosphorylation site of tyrosine 521. |
Modifications | Phospho-specific |