Germany
Japan
United Kingdom
China
Antibodies
View as table Download
MTMR6 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 114-143 amino acids from the N-terminal region of Human MTMR6. |
Rabbit Polyclonal Anti-MTMR7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MTMR7 Antibody is: synthetic peptide directed towards the C-terminal region of Human MTMR7. Synthetic peptide located within the following region: NLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFL |
Rabbit Polyclonal Anti-MTMR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTMR1 antibody: synthetic peptide directed towards the C terminal of human MTMR1. Synthetic peptide located within the following region: KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY |
MTMR6 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MTMR6 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human MTMR6 |
MTMR7 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of Human MTMR7 |
MTMR6 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MTMR6 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Conjugates
- Unconjugated
Families
- Phosphatase
Pathways
- Fructose and mannose metabolism