Rabbit Polyclonal Anti-MAFB Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAFB antibody: synthetic peptide directed towards the middle region of human MAFB. Synthetic peptide located within the following region: YAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEK |
Rabbit Polyclonal Anti-SOX13 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX13 antibody: synthetic peptide directed towards the middle region of human SOX13. Synthetic peptide located within the following region: TARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPM |
Rabbit Polyclonal Anti-ZNF764 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF764 antibody: synthetic peptide directed towards the N terminal of human ZNF764. Synthetic peptide located within the following region: APPLAPLPPRDPNGAGPEWREPGAVSFADVAVYFCREEWGCLRPAQRALY |
Rabbit Polyclonal Anti-ASH2L Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASH2L antibody: synthetic peptide directed towards the N terminal of human ASH2L. Synthetic peptide located within the following region: AAGAAAPPGEGISAAPTVEPSSGEAEGGEANLVDVSGGLETESSNGKDTL |
Rabbit Polyclonal Anti-AIP Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AIP antibody: synthetic peptide directed towards the N terminal of human AIP. Synthetic peptide located within the following region: FHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCTMREGEI |
Rabbit Polyclonal Anti-AIP Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AIP antibody: synthetic peptide directed towards the middle region of human AIP. Synthetic peptide located within the following region: NAQEAQADFAKVLELDPALAPVVSRELQALEARIRQKDEEDKARFRGIFS |
Rabbit Polyclonal Anti-RUNX1T1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RUNX1T1 antibody: synthetic peptide directed towards the middle region of human RUNX1T1. Synthetic peptide located within the following region: RQCNLQQFIQQTGAALPPPPRPDRGPPGTQGPLPPAREESLLGAPSESHA |
Rabbit Polyclonal Anti-EEA1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EEA1 antibody: synthetic peptide directed towards the N terminal of human EEA1. Synthetic peptide located within the following region: ESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDSGHGGESNLALKRDD |
Rabbit Polyclonal Anti-CALR Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CALR antibody: synthetic peptide directed towards the middle region of human CALR. Synthetic peptide located within the following region: PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVT |
Rabbit Polyclonal Anti-CALR Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CALR antibody is: synthetic peptide directed towards the N-terminal region of Human CALR. Synthetic peptide located within the following region: SSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQ |
Rabbit Polyclonal Anti-RASSF7 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RASSF7 antibody: synthetic peptide directed towards the middle region of human RASSF7. Synthetic peptide located within the following region: DISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKY |
Rabbit Polyclonal Anti-ZNF768 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF768 antibody: synthetic peptide directed towards the N terminal of human ZNF768. Synthetic peptide located within the following region: DSQSPEFESQSPRYEPQSPGYEPRSPGYEPRSPGYESESSRYESQNTELK |
Rabbit Polyclonal Anti-TOB2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TOB2 antibody is: synthetic peptide directed towards the middle region of Human TOB2. Synthetic peptide located within the following region: EGHWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRANVPEEL |
Rabbit Polyclonal Anti-ZNF676 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF676 antibody is: synthetic peptide directed towards the middle region of Human ZNF676. Synthetic peptide located within the following region: SSTLTYYKSIHTGEKPYKCEECGKAFSKFSILTKHKVIHTGEKPYKCEEC |
Rabbit Polyclonal Anti-ZNF174 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF174 antibody: synthetic peptide directed towards the middle region of human ZNF174. Synthetic peptide located within the following region: DNKENPQQEGAKGAKPCAVSAGRSKGNGLQNPEPRGANMSEPRLSRRQVS |
Germany
Japan
United Kingdom
China