Antibodies

Jump to Filters
View as table Download
GPD2 Rabbit Polyclonal Antibody
TA351230

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GPD2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPD2
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA322830

USD 380.00

4 Weeks

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A
DGKE Rabbit Polyclonal Antibody
TA338224

USD 539.00

5 Days

Rabbit Polyclonal Anti-DGKE Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKE antibody: synthetic peptide directed towards the N terminal of human DGKE. Synthetic peptide located within the following region: EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA346363

USD 485.00

5 Days

Rabbit Polyclonal Anti-PPAP2A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL
DGKE Rabbit Polyclonal Antibody
TA314761

USD 380.00

In Stock

Rabbit polyclonal anti-DGKE antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKE.
Phosphatidic acid phosphatase type 2B (PLPP3) Rabbit Polyclonal Antibody
AP05176PU-N

USD 580.00

5 Days

Phosphatidic acid phosphatase type 2B (PLPP3) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the phosphatidic acid phosphatase 2B protein
AGPAT3 Rabbit Polyclonal Antibody
TA315627

USD 380.00

4 Weeks

Rabbit polyclonal anti-AGPAT3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AGPAT3.
1 AGP acyltransferase 4 (AGPAT4) Rabbit Polyclonal Antibody
TA315628

USD 380.00

4 Weeks

Rabbit polyclonal anti-AGPAT4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AGPAT4.
GPAT4 Rabbit Polyclonal Antibody
TA349456

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-AGPAT6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human AGPAT6
GPAT4 Rabbit Polyclonal Antibody
TA351863

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-AGPAT6 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human AGPAT6