Antibodies

View as table Download

CD40 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

CD40 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

TNF mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)

Applications WB
Reactivities Human
Conjugation Unconjugated

IL10 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10.

TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS