Antibodies

View as table Download

EPOR mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EPOR mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal EPO Receptor Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human EPO receptor protein (between residues 300-400) [UniProt P19235]

EPOR mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

EPOR (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 328-357 amino acids from the Central region of Human Erythropoietin receptor

Rabbit Polyclonal anti-EPOR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human EPOR

Rabbit Polyclonal anti-EPOR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human EPOR

Rabbit Polyclonal Phospho-Epo-R (Tyr368) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Epo-R around the phosphorylation site of Tyrosine 368
Modifications Phospho-specific

EPOR rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal Epo-R (Ab-426) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human Epo-R.

Rabbit Polyclonal Epo-R Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Epo-R

EPOR Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human EPOR

Rabbit Polyclonal Anti-EPOR Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-EPOR antibody: synthetic peptide directed towards the N terminal of human EPOR. Synthetic peptide located within the following region: DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL