CHSY3 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 640-690 of Human CHSY2. |
CHSY3 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 640-690 of Human CHSY2. |
Rabbit polyclonal anti-CHPH (CHSS2) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CHSS2. |
Rabbit Polyclonal Anti-Chst11 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Chst11 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDS |