Antibodies

View as table Download

ZIC3 mouse monoclonal antibody, clone OTI6F7 (formerly 6F7)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

ZIC3 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZIC3 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ZIC3 mouse monoclonal antibody, clone OTI6F7 (formerly 6F7)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

ZIC3 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7), Biotinylated

Applications WB
Reactivities Human, Mouse
Conjugation Biotin

ZIC3 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7), HRP conjugated

Applications WB
Reactivities Human, Mouse
Conjugation HRP

ZIC3 mouse monoclonal antibody, clone OTI6F7 (formerly 6F7), Biotinylated

Applications WB
Reactivities Human, Mouse
Conjugation Biotin

ZIC3 mouse monoclonal antibody, clone OTI6F7 (formerly 6F7), HRP conjugated

Applications WB
Reactivities Human, Mouse
Conjugation HRP

ZIC3 mouse monoclonal antibody, clone OTI6F7 (formerly 6F7)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-ZIC3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZIC3 Antibody: synthetic peptide directed towards the N terminal of human ZIC3. Synthetic peptide located within the following region: HHHHHTSQVPSYGGAASAAFNSTREFLFRQRSSGLSEAASGGGQHGLFAG

ZIC3 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated