ZIC3 Rabbit Polyclonal Antibody

CAT#: TA334005

Rabbit Polyclonal Anti-ZIC3 Antibody

Product Images

WB Suggested Anti-ZIC3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZIC3 Antibody: synthetic peptide directed towards the N terminal of human ZIC3. Synthetic peptide located within the following region: HHHHHTSQVPSYGGAASAAFNSTREFLFRQRSSGLSEAASGGGQHGLFAG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: Zic family member 3
• Database Link:
  NP_003404
  Entrez Gene 22773 MouseEntrez Gene 7547 Human
  UniProt ID O60481
• Background: This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This nuclear protein probably functions as a transcription factor in early stages of left-right body axis formation. Mutations in this gene cause X-linked visceral heterotaxy, which includes congenital heart disease and left-right axis defects in organs.
• Synonyms: HTX; HTX1; VACTERLX; ZNF203
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%

Reference Data

• Protein Families: Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS