Rabbit Polyclonal MTBP Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | MTBP antibody was raised against a synthetic peptide corresponding to amino acids 122 to 139 of human MTBP, which differ from the mouse sequence by three amino acids (7) . |
MTBP (667-812) mouse monoclonal antibody, clone PHL-1, Ascites
| Applications | ELISA, WB |
| Reactivities | Chimpanzee, Human |
| Conjugation | Unconjugated |
MTBP (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human MTBP |
Rabbit Polyclonal Anti-MTBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MTBP Antibody is: synthetic peptide directed towards the middle region of Human MTBP. Synthetic peptide located within the following region: SLADLYEEAAENLHQLSDKLPAPGRAMVDIILLLSDKDPPKLKDYLPTVG |
Germany
Japan
United Kingdom
China
