Antibodies

Jump to Filters
View as table Download
IGF1 Receptor (IGF1R) Mouse Monoclonal Antibody [Clone ID: OTI4C4]
TA807835

USD 447.00

In Stock

IGF1R mouse monoclonal antibody, clone OTI4C4 (formerly 4C4)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
IGF1 Receptor (IGF1R) Mouse Monoclonal Antibody [Clone ID: OTI11E4]
TA807836

USD 447.00

In Stock

IGF1R mouse monoclonal antibody, clone OTI11E4 (formerly 11E4)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
IGF1 Receptor (IGF1R) Mouse Monoclonal Antibody [Clone ID: OTI4C4]
CF807835

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) IGF1R mouse monoclonal antibody, clone OTI4C4 (formerly 4C4)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
IGF1 Receptor (IGF1R) Mouse Monoclonal Antibody [Clone ID: OTI11E4]
CF807836

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) IGF1R mouse monoclonal antibody, clone OTI11E4 (formerly 11E4)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDE3B Mouse Monoclonal Antibody [Clone ID: OTI3F5]
TA811688

USD 447.00

In Stock

PDE3B mouse monoclonal antibody,clone OTI3F5

Applications WB
Reactivities Human
Conjugation Unconjugated
PDE3B Mouse Monoclonal Antibody [Clone ID: OTI3F5]
CF811688

USD 564.00

4 Weeks

Carrier-free (BSA/glycerol-free) PDE3B mouse monoclonal antibody,clone OTI3F5

Applications WB
Reactivities Human
Conjugation Unconjugated
ADCY3 Rabbit Polyclonal Antibody
TA349673

USD 380.00

In Stock

Rabbit Polyclonal Anti-ADCY3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ADCY3
Adenylate cyclase 1 (ADCY1) (aa 230-280) Rabbit Polyclonal Antibody
AP20473PU-N

USD 465.00

3 Weeks

Adenylate cyclase 1 (ADCY1) (aa 230-280) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 230-280 of Human ADCY 1.
IGF1 Receptor (IGF1R) Rabbit Polyclonal Antibody
TA309698

USD 550.00

2 Weeks

Rabbit Polyclonal IGF1 Receptor Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Primate, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human IGF1R protein (between residues 700-800) [UniProt P08069]
PDE3B (Center) Rabbit Polyclonal Antibody
AP53235PU-N

USD 580.00

2 Weeks

PDE3B (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 400-427 amino acids from the Central region of Human PDE3B
IGF1 Receptor (IGF1R) Rabbit Polyclonal Antibody
TA311815

USD 380.00

In Stock

Rabbit polyclonal IGF1R (Ab-1346) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H).
Modifications Phospho-specific
ADCY5 (+ADCY6) Rabbit Polyclonal Antibody
AP20397PU-N

USD 465.00

3 Weeks

ADCY5 (+ADCY6) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 1111-1160 of Human ADCY 5.
ADCY6 Rabbit Polyclonal Antibody
TA341966

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-ADCY6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY