Rabbit polyclonal anti-GAPDH antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 220 - 290 of Human GAPDH. |
Rabbit polyclonal anti-GAPDH antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 220 - 290 of Human GAPDH. |
Rabbit Polyclonal FALDH Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Feline, Chicken, Dog, Drosophila, Monkey, Pig, Rabbit, Xenopus, Zebrafish, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
USD 539.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit polyclonal anti-GAPDH antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 220 - 290 of Human GAPDH. |
USD 236.00
USD 471.00
In Stock
G6PC Rabbit monoclonal antibody,clone OTIR4H3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 236.00
USD 471.00
In Stock
G6PC Rabbit monoclonal antibody,clone OTIR5G10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 236.00
USD 471.00
In Stock
G6PC Rabbit monoclonal antibody,clone OTIR2H10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Lactate Dehydrogenase A/LDHA Antibody
Applications | ELISA, FC, ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a C-terminal portion of the human Lactate Dehydrogenase A protein (within residues 280-332). [Swiss-Prot# P00338] |
Rabbit Polyclonal PKM2 Antibody
Applications | FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the internal region of human PKM2 protein (within residues 350-450). [Swiss-Prot# P14618] |
Rabbit Polyclonal Anti-PCK1 Antibody
Applications | WB |
Reactivities | Human, Pig |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |
Rabbit anti-ADH5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ADH5 |
Rabbit Polyclonal Anti-PCK1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |
GAPDH (9-323) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Bovine, Canine, Drosophila, Feline, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment corresponding to a region within amino acids 9 and 323 of GAPDH |
Rabbit polyclonal ENOA Antibody (N-term)
Applications | FC, IF, WB |
Reactivities | Human, Mouse (Predicted: Bovine, Monkey) |
Conjugation | Unconjugated |
Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |