Antibodies

View as table Download

KLF9 mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KLF9 mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KLF9 mouse monoclonal antibody, clone OTI8A11 (formerly 8A11), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

KLF9 mouse monoclonal antibody, clone OTI8A11 (formerly 8A11), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

KLF9 mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KLF9 mouse monoclonal antibody, clone OTI6A9 (formerly 6A9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KLF9 mouse monoclonal antibody, clone OTI6A9 (formerly 6A9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KLF9 mouse monoclonal antibody, clone OTI6A9 (formerly 6A9), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

KLF9 mouse monoclonal antibody, clone OTI6A9 (formerly 6A9), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

KLF9 mouse monoclonal antibody, clone OTI6A9 (formerly 6A9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal anti-KLF9 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-KLF9 antibody is: synthetic peptide directed towards the N-terminal region of Human KLF9. Synthetic peptide located within the following region: LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLE