KLF9 Rabbit Polyclonal Antibody

CAT#: TA329250

Rabbit Polyclonal anti-KLF9 Antibody

Product Images

Host: Rabbit; Target Name: KLF9; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0ug/ml

• 

  WB Suggested Anti-KLF9 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat

• 

  Rabbit Anti-KL9 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Testis

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-KLF9 antibody is: synthetic peptide directed towards the N-terminal region of Human KLF9. Synthetic peptide located within the following region: LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: Kruppel-like factor 9
• Database Link:
  NP_001197
  Entrez Gene 117560 RatEntrez Gene 687 Human
  UniProt ID Q13886
• Background: KLF9 is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates transcription.
• Synonyms: BTEB; BTEB1
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 86%