KLF9 mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KLF9 mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KLF9 mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
KLF9 mouse monoclonal antibody, clone OTI8A11 (formerly 8A11), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
KLF9 mouse monoclonal antibody, clone OTI8A11 (formerly 8A11), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
KLF9 mouse monoclonal antibody, clone OTI8A11 (formerly 8A11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KLF9 mouse monoclonal antibody, clone OTI6A9 (formerly 6A9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KLF9 mouse monoclonal antibody, clone OTI6A9 (formerly 6A9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
KLF9 mouse monoclonal antibody, clone OTI6A9 (formerly 6A9), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
KLF9 mouse monoclonal antibody, clone OTI6A9 (formerly 6A9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
KLF9 mouse monoclonal antibody, clone OTI6A9 (formerly 6A9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-KLF9 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-KLF9 antibody is: synthetic peptide directed towards the N-terminal region of Human KLF9. Synthetic peptide located within the following region: LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLE |