Rabbit Polyclonal Anti-KCNG4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNG4 |
Rabbit Polyclonal Anti-KCNG4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNG4 |
Rabbit Polyclonal Anti-KCNK13 Antibody
Applications | IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNK13 antibody: synthetic peptide directed towards the C terminal of human KCNK13. Synthetic peptide located within the following region: GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA |
Rabbit Polyclonal Anti-KCNQ5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KCNQ5 |
Rabbit Polyclonal Anti-KCNA7 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNA7 |
Rabbit Polyclonal Anti-KCND1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCND1 |
Rabbit Polyclonal Anti-KCNG2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNG2 |
Rabbit Polyclonal Anti-KCNK9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNK9 |
Rabbit Polyclonal Anti-KCNQ4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNQ4 |
Rabbit Polyclonal Anti-KCNJ9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNJ9 |
Rabbit Polyclonal Anti-KCNMA1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNMA1 antibody: synthetic peptide directed towards the c terminal region of human KCNMA1. Synthetic peptide located within the following region: CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG |
Anti-KCNH8 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1095-1107 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 8 |
Anti-KCNC2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 16-30 amino acids of Human potassium voltage-gated channel, Shaw-related subfamily, member 2 |
Anti-KCNC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 499-511 amino acids of human potassium voltage-gated channel, Shaw-related subfamily, member 1 |
Rabbit Polyclonal Anti-KCNN2 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat, Macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the C terminal of human KCNN2. Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM |
Rabbit Polyclonal Anti-KCNMA1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KCNMA1 |