Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 31 results

Page 1 of 3

(reset)

Acid sphingomyelinase (SMPD1) Mouse Monoclonal Antibody [Clone ID: OTI3H7]

TA803659

USD 478.00

In Stock

SMPD1 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 22

2 / 22

3 / 22

4 / 22

5 / 22

6 / 22

7 / 22

8 / 22

9 / 22

10 / 22

11 / 22

12 / 22

13 / 22

14 / 22

15 / 22

16 / 22

17 / 22

18 / 22

19 / 22

20 / 22

21 / 22

22 / 22

Previous Next

Acid sphingomyelinase (SMPD1) Mouse Monoclonal Antibody [Clone ID: OTI3H7]

CF803659

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) SMPD1 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 22

2 / 22

3 / 22

4 / 22

5 / 22

6 / 22

7 / 22

8 / 22

9 / 22

10 / 22

11 / 22

12 / 22

13 / 22

14 / 22

15 / 22

16 / 22

17 / 22

18 / 22

19 / 22

20 / 22

21 / 22

22 / 22

Previous Next

Neuraminidase (NEU1) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

TA801727

USD 447.00

In Stock

NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Acid sphingomyelinase (SMPD1) Mouse Monoclonal Antibody [Clone ID: OTI3H7]

TA803659S

USD 200.00

In Stock

SMPD1 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 22

2 / 22

3 / 22

4 / 22

5 / 22

6 / 22

7 / 22

8 / 22

9 / 22

10 / 22

11 / 22

12 / 22

13 / 22

14 / 22

15 / 22

16 / 22

17 / 22

18 / 22

19 / 22

20 / 22

21 / 22

22 / 22

Previous Next

PPAP2A (PLPP1) Mouse Monoclonal Antibody [Clone ID: OTI1H4]

TA506857

USD 447.00

In Stock

PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Neuraminidase (NEU1) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

CF801727

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Neuraminidase (NEU1) Mouse Monoclonal Antibody [Clone ID: OTI3B3]

TA801666

USD 447.00

In Stock

NEU1 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Neuraminidase (NEU1) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

TA801727S

USD 200.00

In Stock

NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

PPAP2A (PLPP1) Mouse Monoclonal Antibody [Clone ID: OTI1H4]

CF506857

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Neuraminidase (NEU1) Mouse Monoclonal Antibody [Clone ID: OTI3B3]

CF801666

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) NEU1 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Neuraminidase (NEU1) Rabbit Polyclonal Antibody

TA335236

USD 485.00

2 Weeks

Rabbit Polyclonal Anti-NEU1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG

1 / 2

2 / 2

Previous Next

ASAH2 Rabbit Polyclonal Antibody

TA349659

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-ASAH2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human ASAH2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Neuraminidase (NEU1) Mouse Monoclonal Antibody [Clone ID: OTI3B3]

TA801666S

USD 200.00

2 Days

NEU1 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PPAP2A (PLPP1) Rabbit Polyclonal Antibody

TA322830

USD 380.00

4 Weeks

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Phytoceramidase (ACER3) Rabbit Polyclonal Antibody

TA315581

USD 380.00

4 Weeks

Rabbit polyclonal anti-PHCA antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human PHCA.

1 / 3

2 / 3

3 / 3

Previous Next

1 - 15 of 31 results

Page 1 of 3