Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 8 of 8 results

(reset)

VMAT2 (SLC18A2) Mouse Monoclonal Antibody [Clone ID: OTI9E11]

TA500506

USD 478.00

In Stock

Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI9E11 (formerly 9E11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

UBC6e (UBE2J1) Mouse Monoclonal Antibody [Clone ID: OTI3D1]

TA504988

USD 447.00

In Stock

UBE2J1 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications	FC, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

UBC6e (UBE2J1) Mouse Monoclonal Antibody [Clone ID: OTI3D1]

TA504988S

USD 200.00

2 Days

UBE2J1 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)

Applications	FC, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

VMAT2 (SLC18A2) Mouse Monoclonal Antibody [Clone ID: OTI9E11]

TA500506S

USD 200.00

In Stock

Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI9E11 (formerly 9E11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

VMAT2 (SLC18A2) Mouse Monoclonal Antibody [Clone ID: OTI10C11]

CF500463

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) SLC18A2 mouse monoclonal antibody, clone OTI10C11 (formerly 10C11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TRPC1 Rabbit Polyclonal Antibody

TA328677

USD 905.00

3 Weeks

Rabbit Polyclonal Anti-TRPC1

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide QLYDKGYTSKEQKDC, corresponding to amino acid residues 557-571 of human TRPC1.Intracellular.

1 / 2

2 / 2

Previous Next

Cytochrome b c1 complex subunit 9 (UQCR10) Rabbit Polyclonal Antibody

TA335305

USD 539.00

5 Days

Rabbit Polyclonal Anti-UCRC Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

1 / 2

2 / 2

Previous Next

VMAT2 (SLC18A2) Rabbit Polyclonal Antibody

TA309861

USD 625.00

In Stock

Rabbit Polyclonal VMAT2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A genomic peptide made to an internal region of the human VMAT2 protein (within residues 30-200). [Swiss-Prot Q05940]

1 - 8 of 8 results