Rabbit Polyclonal Anti-UBP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human UBP1 |
Rabbit Polyclonal Anti-UBP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human UBP1 |
Rabbit polyclonal UBP1 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse) |
Conjugation | Unconjugated |
Immunogen | This UBP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 266-295 amino acids from the Central region of human UBP1. |
Rabbit Polyclonal Anti-UBP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-UBP1 Antibody: synthetic peptide directed towards the middle region of human UBP1. Synthetic peptide located within the following region: GASQTSGEQIQPSATIQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKED |