Antibodies

View as table Download

Rabbit Polyclonal Anti-UBP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UBP1

Rabbit polyclonal UBP1 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This UBP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 266-295 amino acids from the Central region of human UBP1.

Rabbit Polyclonal Anti-UBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-UBP1 Antibody: synthetic peptide directed towards the middle region of human UBP1. Synthetic peptide located within the following region: GASQTSGEQIQPSATIQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKED